Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50072081
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1523466
IC50 0.500000±n/a nM
Citation Dounay ABTuttle JBVerhoest PR Challenges and Opportunities in the Discovery of New Therapeutics Targeting the Kynurenine Pathway. J Med Chem 58:8762-82 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55831.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1487479
Residue:486
Sequence:
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072081
n/a
NameBDBM50072081
Synonyms:CHEMBL3407922
TypeSmall organic molecule
Emp. Form.C14H11ClN2O3
Mol. Mass.290.702
SMILESOC(=O)c1cc(ncn1)-c1ccc(OC2CC2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: