| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Folate receptor alpha |
|---|
| Ligand | BDBM50126172 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1523801 (CHEMBL3632252) |
|---|
| IC50 | 0.330000±n/a nM |
|---|
| Citation |  Wang, L; Wallace, A; Raghavan, S; Deis, SM; Wilson, MR; Yang, S; Polin, L; White, K; Kushner, J; Orr, S; George, C; O'Connor, C; Hou, Z; Mitchell-Ryan, S; Dann, CE; Matherly, LH; Gangjee, A 6-Substituted Pyrrolo[2,3-d]pyrimidine Thienoyl Regioisomers as Targeted Antifolates for Folate Receptora and the Proton-Coupled Folate Transporter in Human Tumors. J Med Chem58:6938-59 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Folate receptor alpha |
|---|
| Name: | Folate receptor alpha |
|---|
| Synonyms: | Adult folate-binding protein | FBP | FOLR | FOLR1 | FOLR1_HUMAN | FR-alpha | Folate receptor 1 | Folate receptor, adult | KB cells FBP | Ovarian tumor-associated antigen MOv18 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29827.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469596 |
|---|
| Residue: | 257 |
|---|
| Sequence: | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
|
|
|
|---|
| BDBM50126172 |
|---|
| n/a |
|---|
| Name | BDBM50126172 |
|---|
| Synonyms: | CHEMBL3628344 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H21N5O6S |
|---|
| Mol. Mass. | 447.465 |
|---|
| SMILES | Nc1nc2[nH]c(CCCc3csc(c3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cc2c(=O)[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
