Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptophan 2,3-dioxygenase
LigandBDBM50127136
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1524691
IC50 561±n/a nM
Citation Wu JSLin SYLiao FYHsiao WCLee LCPeng YHHsieh CLWu MHSong JSYueh AChen CHYeh SHLiu CYLin SYYeh TKHsu JTShih CUeng SHHung MSWu SY Identification of Substituted Naphthotriazolediones as Novel Tryptophan 2,3-Dioxygenase (TDO) Inhibitors through Structure-Based Virtual Screening. J Med Chem 58:7807-19 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tryptophan 2,3-dioxygenase
Name:Tryptophan 2,3-dioxygenase
Synonyms:TDO | TDO2 | TO | TRPO | Tryptamin 2,3-dioxygenase | Tryptophan oxygenase | Tryptophan pyrrolase | Tryptophanase
Type:PROTEIN
Mol. Mass.:47874.48
Organism:Homo sapiens (Human)
Description:ChEMBL_825691
Residue:406
Sequence:
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50127136
n/a
NameBDBM50127136
Synonyms:CHEMBL1442185
TypeSmall organic molecule
Emp. Form.C18H13N3O2
Mol. Mass.303.3147
SMILESCc1ccccc1Cn1nnc2c1C(=O)c1ccccc1C2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: