Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM50129817
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1524111
IC50>1.000000±n/a nM
Citation Zhou ZZGe BCChen YFShi XDYang XMXu JP Catecholic amides as potential selective phosphodiesterase 4D inhibitors: Design, synthesis, pharmacological evaluation and structure-activity relationships. Bioorg Med Chem 23:7332-9 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:3',5'-cyclic phosphodiesterase
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (Human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129817
n/a
NameBDBM50129817
Synonyms:CHEMBL3628685
TypeSmall organic molecule
Emp. Form.C21H23F2NO4
Mol. Mass.391.4084
SMILESCOc1ccc(CNC(=O)c2ccc(OC(F)F)c(OC3CCCC3)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: