Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated sodium channel alpha subunit Nav1.1
LigandBDBM50130535
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1525517
IC50 670±n/a nM
Citation Suzuki SKuroda TKimoto HDomon YKubota KKitano YYokoyama TShimizugawa ASugita RKoishi RAsano DTamaki KShinozuka TKobayashi H Discovery of (phenoxy-2-hydroxypropyl)piperidines as a novel class of voltage-gated sodium channel 1.7 inhibitors. Bioorg Med Chem Lett 25:5419-23 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated sodium channel alpha subunit Nav1.1
Name:Voltage-gated sodium channel alpha subunit Nav1.1
Synonyms:Scn1a | Voltage-gated sodium channel alpha subunit Nav1.1
Type:PROTEIN
Mol. Mass.:25514.04
Organism:Mus musculus
Description:ChEMBL_109872
Residue:220
Sequence:
QKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIM
ILICLNMVTMMVETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFD
FVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLP
ALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130535
n/a
NameBDBM50130535
Synonyms:CHEMBL3632695
TypeSmall organic molecule
Emp. Form.C29H33F3N2O8
Mol. Mass.594.5761
SMILESOC(=O)\C=C\C(O)=O.COc1cc(ccc1COCC(O)CN1CCC(CC1)N1Cc2ccccc2C1=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: