Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 2
LigandBDBM50130696
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1527068
Ki>10000±n/a nM
Citation Teo TYang YYu MBasnet SKGillam THou JSchmid RMKumarasiri MDiab SAlbrecht HSykes MJWang S An integrated approach for discovery of highly potent and selective Mnk inhibitors: Screening, synthesis and SAR analysis. Eur J Med Chem 103:539-50 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 2
Name:MAP kinase-interacting serine/threonine-protein kinase 1/2
Synonyms:GPRK7 | MAP kinase signal-integrating kinase 2 | MAP kinase-interacting serine/threonine-protein kinase 2 (MKNK2) | MAP kinase-interacting serine/threonine-protein kinase 2 (MnK2) | MAP-kinase interacting kinase 2 (MNK2) | MKNK2 | MNK2
Type:Protein
Mol. Mass.:51870.79
Organism:Homo sapiens (Human)
Description:Q9HBH9
Residue:465
Sequence:
MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAK
KRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50130696
n/a
NameBDBM50130696
Synonyms:CHEMBL3632738
TypeSmall organic molecule
Emp. Form.C16H14FN3O2S
Mol. Mass.331.365
SMILESCOC(=O)c1sc2ncnc(Nc3ccc(F)cc3C)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: