Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1
LigandBDBM98036
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1527074
Ki>10000±n/a nM
Citation Teo TYang YYu MBasnet SKGillam THou JSchmid RMKumarasiri MDiab SAlbrecht HSykes MJWang S An integrated approach for discovery of highly potent and selective Mnk inhibitors: Screening, synthesis and SAR analysis. Eur J Med Chem 103:539-50 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1
Name:MAP kinase-interacting serine/threonine-protein kinase 1
Synonyms:MAP Kinase-Interacting Protein Kinase (MNK1) | MAP kinase signal-integrating kinase 1 | MAP kinase-interacting serine/threonine-protein kinase 1 (MnK1) | MAP kinase-interacting serine/threonine-protein kinase MNK1 | MAP-kinase interacting kinase 1 (MNK1) | MAPK signal-integrating kinase 1
Type:Serine/threonine-protein kinase
Mol. Mass.:51342.85
Organism:Homo sapiens (Human)
Description:Q9BUB5
Residue:465
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM98036
n/a
NameBDBM98036
Synonyms:US8486953, 19
TypeSmall organic molecule
Emp. Form.C18H18FN3O3S
Mol. Mass.375.417
SMILESCOC(=O)c1sc2ncnc(Nc3ccc(F)cc3OC(C)C)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: