| Reaction Details |
|---|
 | Report a problem with these data |
| Target | X-box-binding protein 1 |
|---|
| Ligand | BDBM50131222 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1526682 |
|---|
| EC50 | 420±n/a nM |
|---|
| Citation |  Ren, J; Wang, YG; Wang, AG; Wu, LQ; Zhang, HJ; Wang, WJ; Su, YL; Qin, HL Cembranoids from the Gum Resin of Boswellia carterii as Potential Antiulcerative Colitis Agents. J Nat Prod78:2322-31 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| X-box-binding protein 1 |
|---|
| Name: | X-box-binding protein 1 |
|---|
| Synonyms: | Hepatocarcinogenesis-related transcription factor | Htf | X-box-binding protein 1 | X-box-binding protein 1, cytoplasmic form | X-box-binding protein 1, luminal form | XBP1_RAT | Xbp1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29677.58 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_109918 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MVVVAAAPSAASAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHL
SPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLQLENQLLREKTHGLV
IENQELRTRLGMNALVTEEVSEAESKGNGVRLVAGSAESAALRLRAPLQQVQAQLSPPQN
IFPWILTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLIWRNSQRSTQKDLVPYQPPF
LCQWGPHQPSWKPLMNSFVLTMYTPSL
|
|
|
|---|
| BDBM50131222 |
|---|
| n/a |
|---|
| Name | BDBM50131222 |
|---|
| Synonyms: | CHEMBL3634662 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H32O4 |
|---|
| Mol. Mass. | 336.4657 |
|---|
| SMILES | [H][C@@]12C[C@@]3(CC[C@@](C)(O3)[C@H](O)CC(=O)\C(C)=C\CC[C@@]1(C)O2)C(C)C |r,t:16| |
|---|
| Structure | 
|
|---|
Search and Browse
