Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM50131225
Substrate/Competitorn/a
Meas. Tech.ChEBML_1526828
Ki 0.015000±n/a nM
Citation Hu HWang XChan GKChang JHDo SDrummond JEbens ALee WLy JLyssikatos JPMurray JMoffat JGChao QTsui VWallweber HKolesnikov A Discovery of 3,5-substituted 6-azaindazoles as potent pan-Pim inhibitors. Bioorg Med Chem Lett 25:5258-64 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase pim-1
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131225
n/a
NameBDBM50131225
Synonyms:CHEMBL3634769 | US9260425, 515
TypeSmall organic molecule
Emp. Form.C21H22N8O
Mol. Mass.402.4524
SMILESCCn1cncc(-c2cc3c(n[nH]c3cn2)-c2cccc(n2)N2CCNCC2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: