Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-2
LigandBDBM50131227
Substrate/Competitorn/a
Meas. Tech.ChEBML_1526829
Ki 0.127000±n/a nM
Citation Hu HWang XChan GKChang JHDo SDrummond JEbens ALee WLy JLyssikatos JPMurray JMoffat JGChao QTsui VWallweber HKolesnikov A Discovery of 3,5-substituted 6-azaindazoles as potent pan-Pim inhibitors. Bioorg Med Chem Lett 25:5258-64 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-2
Name:Serine/threonine-protein kinase pim-2
Synonyms:Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase pim-2 (PIM2)
Type:Serine/threonine-protein kinase
Mol. Mass.:34185.93
Organism:Homo sapiens (Human)
Description:Q9P1W9
Residue:311
Sequence:
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131227
n/a
NameBDBM50131227
Synonyms:CHEMBL3634771 | US9260425, 473
TypeSmall organic molecule
Emp. Form.C20H19N9
Mol. Mass.385.4252
SMILESN#CCn1cc(cn1)-c1cc2c(n[nH]c2cn1)-c1cccc(n1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: