| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50131375 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1526828 |
|---|
| Ki | 0.100000±n/a nM |
|---|
| Citation |  Hu, H; Wang, X; Chan, GK; Chang, JH; Do, S; Drummond, J; Ebens, A; Lee, W; Ly, J; Lyssikatos, JP; Murray, J; Moffat, JG; Chao, Q; Tsui, V; Wallweber, H; Kolesnikov, A Discovery of 3,5-substituted 6-azaindazoles as potent pan-Pim inhibitors. Bioorg Med Chem Lett25:5258-64 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50131375 |
|---|
| n/a |
|---|
| Name | BDBM50131375 |
|---|
| Synonyms: | CHEMBL3634779 | US9260425, 147 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20FN7 |
|---|
| Mol. Mass. | 389.4288 |
|---|
| SMILES | NC1CCN(CC1)c1cncc(n1)-c1cc2c(n[nH]c2cn1)-c1ccccc1F |
|---|
| Structure | 
|
|---|
Search and Browse
