Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50131399 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1526857 (CHEMBL3636925) |
---|
Ki | 398±n/a nM |
---|
Citation | Narlawar, R; Werry, EL; Scarf, AM; Hanani, R; Chua, SW; King, VA; Barron, ML; Martins, RN; Ittner, LM; Rendina, LM; Kassiou, M First Demonstration of Positive Allosteric-like Modulation at the Human Wild Type Translocator Protein (TSPO). J Med Chem58:8743-9 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM50131399 |
---|
n/a |
---|
Name | BDBM50131399 |
Synonyms: | CHEMBL3634877 |
Type | Small organic molecule |
Emp. Form. | C22H27N3O2 |
Mol. Mass. | 365.4687 |
SMILES | CCN(CC)C(=O)Cn1c(nc2c(C)cc(C)cc12)-c1ccc(OC)cc1 |
Structure |
|