Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VB
LigandBDBM50131680
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1523554
Ki 820±n/a nM
Citation Maresca AAkyuz GOsman SMAlOthman ZSupuran CT Inhibition of mammalian carbonic anhydrase isoforms I-XIV with a series of phenolic acid esters. Bioorg Med Chem 23:7181-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VB
Name:Carbonic Anhydrase VB
Synonyms:CA-VB | Carbonate dehydratase VB | Carbonic anhydrase 5B (CA VB) | Carbonic anhydrase 5B, mitochondrial | Carbonic anhydrase 5B, mitochondrial precursor | Carbonic anhydrase VB (CA VB)
Type:Enzyme
Mol. Mass.:36440.83
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:317
Sequence:
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131680
n/a
NameBDBM50131680
Synonyms:CHEMBL3628212
TypeSmall organic molecule
Emp. Form.C17H16O4
Mol. Mass.284.3065
SMILESOc1ccc(\C=C\C(=O)OCCc2cccc(O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: