Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIII
LigandBDBM50131679
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1523559
Ki 13900±n/a nM
Citation Maresca AAkyuz GOsman SMAlOthman ZSupuran CT Inhibition of mammalian carbonic anhydrase isoforms I-XIV with a series of phenolic acid esters. Bioorg Med Chem 23:7181-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIII
Name:Carbonic anhydrase XIII
Synonyms:CA-XIII | Carbonate dehydratase XIII | Carbonic anhydrase 13
Type:Enzyme
Mol. Mass.:29522.80
Organism:Mus musculus (mouse)
Description:Murine cloned isozyme
Residue:262
Sequence:
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131679
n/a
NameBDBM50131679
Synonyms:CHEMBL3628211 | p-Hydroxyphenylethyl p-coumarate (17)
TypeSmall organic molecule
Emp. Form.C17H16O4
Mol. Mass.284.3065
SMILESOc1ccc(CCOC(=O)\C=C\c2ccc(O)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: