Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIV
LigandBDBM50259746
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1523560
Ki 720±n/a nM
Citation Maresca AAkyuz GOsman SMAlOthman ZSupuran CT Inhibition of mammalian carbonic anhydrase isoforms I-XIV with a series of phenolic acid esters. Bioorg Med Chem 23:7181-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIV
Name:Carbonic Anhydrase XIV
Synonyms:CA-XIV | Carbonate dehydratase XIV | Carbonic anhydrase 14 | Carbonic anhydrase 14 (CA XIV) | Carbonic anhydrase XIV (CA XIV)
Type:Enzyme
Mol. Mass.:37665.67
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme.
Residue:337
Sequence:
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259746
n/a
NameBDBM50259746
Synonyms:(4-Hydroxyphenyl)ethyl trans-ferulate | CHEMBL481245 | p-Hydroxyphenethyl trans-ferulate (18) | p-hydroxyphenethyl trans-ferulate
TypeSmall organic molecule
Emp. Form.C18H18O5
Mol. Mass.314.3325
SMILESCOc1cc(\C=C\C(=O)OCCc2ccc(O)cc2)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: