Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Fyn
LigandBDBM50131822
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1526221
IC50 220±n/a nM
Citation Williams TESubramanian SVerhagen JMcBride CMCostales ASung LAntonios-McCrea WMcKenna MLouie AKRamurthy SLevine BShafer CMMachajewski TRenhowe PAAppleton BAAmiri PChou JStuart DAardalen KPoon D Discovery of RAF265: A Potent mut-B-RAF Inhibitor for the Treatment of Metastatic Melanoma. ACS Med Chem Lett 6:961-5 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Fyn
Name:Tyrosine-protein kinase Fyn
Synonyms:FYN | Proto-oncogene Syn | Proto-oncogene c-Fyn | SLK | Src-like kinase | p59-Fyn
Type:Enzyme
Mol. Mass.:60762.21
Organism:Homo sapiens (Human)
Description:P06241
Residue:537
Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131822
n/a
NameBDBM50131822
Synonyms:CHEMBL3632719
TypeSmall organic molecule
Emp. Form.C27H25F3N6O
Mol. Mass.506.5222
SMILESCn1c(Nc2cccc(c2)C(C)(C)C)nc2cc(Oc3ccnc(c3)-c3ncc([nH]3)C(F)(F)F)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: