Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2A adrenergic receptor
LigandBDBM50132341
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1527395
Ki<300±n/a nM
Citation Ponnala SKapadia NMadapa SAlberts ILHarding WW Synthesis and evaluation of aporphine analogs containing C1 allyl isosteres at the h5-HT(2A) receptor. Bioorg Med Chem Lett 25:5102-6 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-2A adrenergic receptor
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:48979.91
Organism:Homo sapiens (Human)
Description:P08913
Residue:450
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132341
n/a
NameBDBM50132341
Synonyms:CHEMBL3633757
TypeSmall organic molecule
Emp. Form.C26H24BrNO4
Mol. Mass.494.377
SMILESCOc1cc2CCN(C)C3Cc4cc5OCOc5cc4-c(c1OCc1ccc(Br)cc1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: