Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIV
LigandBDBM50133409
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1525822
Ki 0.670000±n/a nM
Citation La Regina GColuccia AFamiglini VPelliccia SMonti LVullo DNuti EAlterio VDe Simone GMonti SMPan PParkkila SSupuran CTRossello ASilvestri R Discovery of 1,1'-Biphenyl-4-sulfonamides as a New Class of Potent and Selective Carbonic Anhydrase XIV Inhibitors. J Med Chem 58:8564-72 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIV
Name:Carbonic Anhydrase XIV
Synonyms:CA-XIV | Carbonate dehydratase XIV | Carbonic anhydrase 14 | Carbonic anhydrase 14 (CA XIV) | Carbonic anhydrase XIV (CA XIV)
Type:Enzyme
Mol. Mass.:37665.67
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme.
Residue:337
Sequence:
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133409
n/a
NameBDBM50133409
Synonyms:CHEMBL3632845
TypeSmall organic molecule
Emp. Form.C19H18N2O2S
Mol. Mass.338.423
SMILESNc1ccc(Cc2ccc(cc2)-c2ccc(cc2)S(N)(=O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: