Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsocitrate dehydrogenase [NADP] cytoplasmic
LigandBDBM50241453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1525980
Ki 3170±n/a nM
Citation Kim HJFei XCho SCChoi BYAhn HCLee KSeo SYKeum YS Discovery ofa-mangostin as a novel competitive inhibitor against mutant isocitrate dehydrogenase-1. Bioorg Med Chem Lett 25:5625-31 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Isocitrate dehydrogenase [NADP] cytoplasmic
Name:Isocitrate dehydrogenase [NADP] cytoplasmic
Synonyms:Cytosolic NADP-isocitrate dehydrogenase | IDH | IDH1 | IDP | Isocitrate Dehydrogenase (IDH1) | Isocitrate dehydrogenase 1 (IDH1) | NADP(+)-specific ICDH | Oxalosuccinate decarboxylase | PICD
Type:Protein
Mol. Mass.:46661.29
Organism:Homo sapiens (Human)
Description:O75874
Residue:414
Sequence:
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50241453
n/a
NameBDBM50241453
Synonyms:1,3,6,7-tetrahydroxy-2,8-bis(3-methylbut-2-enyl)-9H-xanthen-9-one | CHEMBL260553 | gamma-mangostin
TypeSmall organic molecule
Emp. Form.C23H24O6
Mol. Mass.396.4331
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-c1c(-[#8])cc2oc3cc(-[#8])c(-[#8])c(-[#6]\[#6]=[#6](\[#6])-[#6])c3c(=O)c2c1-[#8]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: