Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin/mu opioid receptor
LigandBDBM50133893
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1526571
Ki 0.390000±n/a nM
Citation Harland AAYeomans LGriggs NWAnand JPPogozheva IDJutkiewicz EMTraynor JRMosberg HI Further Optimization and Evaluation of Bioavailable, Mixed-Efficacy-Opioid Receptor (MOR) Agonists/d-Opioid Receptor (DOR) Antagonists: Balancing MOR and DOR Affinities. J Med Chem 58:8952-69 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Nociceptin/mu opioid receptor
Name:Nociceptin/mu opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133893
n/a
NameBDBM50133893
Synonyms:CHEMBL3634255
TypeSmall organic molecule
Emp. Form.C32H34N2O2
Mol. Mass.478.6246
SMILESCc1cc(O)cc(C)c1C[C@H](N)C(=O)N[C@@H]1CCCc2ccc(Cc3cccc4ccccc34)cc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: