Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM50134710
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1543868
Ki 151±n/a nM
Citation Tan XSong YHPark CLee KWKim JYKim DWKim KDLee KWCurtis-Long MJPark KH Highly potent tyrosinase inhibitor, neorauflavane from Campylotropis hirtella and inhibitory mechanism with molecular docking. Bioorg Med Chem 24:153-9 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Monophenol monooxygenase | Monophenol oxidase
Type:Protein
Mol. Mass.:63923.66
Organism:Agaricus bisporus (Common mushroom)
Description:O42713
Residue:556
Sequence:
MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLP
FTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWV
QAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPY
GDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDD
QHANSLESVHDDIHVMVGYGKIEGHMDHPFFAAFDPIFWLHHTNVDRLLSLWKAINPDVW
VTSGRNRDGTMGIAPNAQINSETPLEPFYQSGDKVWTSASLADTARLGYSYPDFDKLVGG
TKELIRDAIDDLIDERYGSKPSSGARNTAFDLLADFKGITKEHKEDLKMYDWTIHVAFKK
FELKESFSLLFYFASDGGDYDQENCFVGSINAFRGTAPETCANCQDNENLIQEGFIHLNH
YLARDLESFEPQDVHKFLKEKGLSYKLYSRGDKPLTSLSVKIEGRPLHLPPGEHRPKYDH
TQARVVFDDVAVHVIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134710
n/a
NameBDBM50134710
Synonyms:CHEMBL3745886
TypeSmall organic molecule
Emp. Form.C25H28O6
Mol. Mass.424.4862
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-c1c(-[#8])ccc(-[#6]-2-[#6]-[#8]-c3cc(-[#8])cc(-[#8])c3-[#6]-2=O)c1-[#8]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: