Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTestis-specific serine/threonine-protein kinase 3
LigandBDBM50135286
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1543473
IC50>5000±n/a nM
Citation Reddy MVAkula BJatiani SVasquez-Del Carpio RBilla VKMallireddigari MRCosenza SCVenkata Subbaiah DRBharathi EVPallela VRRamkumar PJain RAggarwal AKReddy EP Discovery of 2-(1H-indol-5-ylamino)-6-(2,4-difluorophenylsulfonyl)-8-methylpyrido[2,3-d]pyrimidin-7(8H)-one (7ao) as a potent selective inhibitor of Polo like kinase 2 (PLK2). Bioorg Med Chem 24:521-44 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Testis-specific serine/threonine-protein kinase 3
Name:Testis-specific serine/threonine-protein kinase 3
Synonyms:SPOGA3 | STK22C | Serine/threonine-protein kinase 22C | TSK-3 | TSSK-3 | TSSK3 | Testis-specific kinase 3 | Testis-specific serine/threonine-protein kinase 3
Type:PROTEIN
Mol. Mass.:30102.61
Organism:Homo sapiens (Human)
Description:ChEMBL_109599
Residue:268
Sequence:
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLSISADCQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135286
n/a
NameBDBM50135286
Synonyms:CHEMBL3745885
TypeSmall organic molecule
Emp. Form.C22H15F2N5O3S
Mol. Mass.467.448
SMILESCn1c2nc(Nc3ccc4[nH]ccc4c3)ncc2cc(c1=O)S(=O)(=O)c1ccc(F)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: