Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue-type plasminogen activator
LigandBDBM50136573
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1548528
Ki>8600±n/a nM
Citation Smith LMOrwat MJHu ZHan WWang CRossi KAGilligan PJPabbisetty KBOsuna HCorte JRRendina ARLuettgen JMWong PCNarayanan RHarper TWBozarth JMCrain EJWei ARamamurthy VMorin PEXin BZheng JSeiffert DAQuan MLLam PYWexler RRPinto DJ Novel phenylalanine derived diamides as Factor XIa inhibitors. Bioorg Med Chem Lett 26:472-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tissue-type plasminogen activator
Name:Tissue-type plasminogen activator
Synonyms:Alteplase | Reteplase | Thrombin receptor protein | Tissue-type plasminogen activator | Tissue-type plasminogen activator (tPA) | Tissue-type plasminogen activator precursor | t-PA | t-Plasminogen Activator (tPA) | t-plasminogen activator
Type:Enzyme
Mol. Mass.:62931.08
Organism:Homo sapiens (Human)
Description:n/a
Residue:562
Sequence:
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50136573
n/a
NameBDBM50136573
Synonyms:CHEMBL3752047
TypeSmall organic molecule
Emp. Form.C32H32ClN9O5
Mol. Mass.658.107
SMILESCN1CCN(CC1)C(=O)Nc1ccc(C[C@H](NC(=O)\C=C\c2cc(Cl)ccc2-n2cnnn2)C(=O)Nc2ccc(cc2)C(O)=O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: