Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasma kallikrein
LigandBDBM50136575
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1548351
Ki 7.5±n/a nM
Citation Smith LMOrwat MJHu ZHan WWang CRossi KAGilligan PJPabbisetty KBOsuna HCorte JRRendina ARLuettgen JMWong PCNarayanan RHarper TWBozarth JMCrain EJWei ARamamurthy VMorin PEXin BZheng JSeiffert DAQuan MLLam PYWexler RRPinto DJ Novel phenylalanine derived diamides as Factor XIa inhibitors. Bioorg Med Chem Lett 26:472-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Plasma kallikrein
Name:Plasma kallikrein
Synonyms:Fletcher factor | Kallikrein | Kininogenin | Plasma kallikrein heavy chain | Plasma kallikrein light chain | Plasma prekallikrein
Type:Protein
Mol. Mass.:71391.16
Organism:Homo sapiens (Human)
Description:P03952
Residue:638
Sequence:
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50136575
n/a
NameBDBM50136575
Synonyms:CHEMBL3752610
TypeSmall organic molecule
Emp. Form.C31H27ClFN7O5
Mol. Mass.632.041
SMILESCC1CC1C(=O)Nc1ccc(C[C@H](NC(=O)\C=C\c2c(F)c(Cl)ccc2-n2cnnn2)C(=O)Nc2ccc(cc2)C(O)=O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: