| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pantothenate synthetase |
|---|
| Ligand | BDBM50139062 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1547921 (CHEMBL3756998) |
|---|
| IC50 | 1120±n/a nM |
|---|
| Citation |  Malothu, N; Bhandaru, JS; Kulandaivelu, U; Jojula, M; Adidala, RR; K R, U; A V N, D; Kaki, VR; Akkinepally, RR Synthesis, in vitro antimycobacterial evaluation and docking studies of some new 5,6,7,8-tetrahydropyrido[4',3':4,5]thieno[2,3-d]pyrimidin-4(3H)-one schiff bases. Bioorg Med Chem Lett26:836-40 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Pantothenate synthetase |
|---|
| Name: | Pantothenate synthetase |
|---|
| Synonyms: | Chain A, Crystal Structure Of A Pantothenate Synthetase, Apo Enzyme In C2 Space Group | PANC_MYCTU | Pantothenate synthetase | panC |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 32675.10 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | ChEMBL_102878 |
|---|
| Residue: | 309 |
|---|
| Sequence: | MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGS
VVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQP
GPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVA
VVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLD
AAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR
AILESHWRN
|
|
|
|---|
| BDBM50139062 |
|---|
| n/a |
|---|
| Name | BDBM50139062 |
|---|
| Synonyms: | CHEMBL3752173 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18N4O4S2 |
|---|
| Mol. Mass. | 442.511 |
|---|
| SMILES | NC(=O)c1c(NC(=O)c2ccc(s2)[N+]([O-])=O)sc2CN(Cc3ccccc3)CCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
