Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50139752
Substrate/Competitorn/a
Meas. Tech.ChEBML_1553863
Ki 2.9±n/a nM
Citation Zhou GAslanian RGallo GKhan TKuang RPurakkattle BDe Ruiz MStamford ATing PWu HWang HXiao DYu TZhang YMullins DHodgson R Discovery of aminoquinazoline derivatives as human A(2A) adenosine receptor antagonists. Bioorg Med Chem Lett 26:1348-54 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139752
n/a
NameBDBM50139752
Synonyms:CHEMBL3764434 | US10138212, Example 91
TypeSmall organic molecule
Emp. Form.C19H14ClN5O
Mol. Mass.363.8
SMILESNc1nc(C(=O)NCc2cccc3cccnc23)c2cccc(Cl)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: