Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D
LigandBDBM50140054
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1550135
Ki 214±n/a nM
Citation Cozzi NVDaley PF Receptor binding profiles and quantitative structure-affinity relationships of some 5-substituted-N,N-diallyltryptamines. Bioorg Med Chem Lett 26:959-64 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1D
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | Serotonin Receptor 1D
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41920.63
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:377
Sequence:
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140054
n/a
NameBDBM50140054
Synonyms:CHEMBL3752900
TypeSmall organic molecule
Emp. Form.C16H19ClN2
Mol. Mass.274.788
SMILESClc1ccc2[nH]cc(CCN(CC=C)CC=C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: