Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor (2b and 2c)
LigandBDBM50140053
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1550138
Ki 17±n/a nM
Citation Cozzi NVDaley PF Receptor binding profiles and quantitative structure-affinity relationships of some 5-substituted-N,N-diallyltryptamines. Bioorg Med Chem Lett 26:959-64 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor (2b and 2c)
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2B | 5-HT2B | 5-hydroxytryptamine (serotonin) receptor 2B [Homo sapiens] | 5-hydroxytryptamine receptor 2B | 5-hydroxytryptamine receptor 2B (5-HT2B) | 5-hydroxytryptamine receptor 2C (5HT2C) | Serotonin (5-HT3) receptor | Serotonin 2b (5-HT2b) receptor | Serotonin Receptor 2B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:54312.47
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:481
Sequence:
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140053
n/a
NameBDBM50140053
Synonyms:CHEMBL3754496
TypeSmall organic molecule
Emp. Form.C16H19FN2
Mol. Mass.258.3339
SMILESFc1ccc2[nH]cc(CCN(CC=C)CC=C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: