Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM50140053
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1550159
Ki 36±n/a nM
Citation Cozzi NVDaley PF Receptor binding profiles and quantitative structure-affinity relationships of some 5-substituted-N,N-diallyltryptamines. Bioorg Med Chem Lett 26:959-64 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent serotonin transporter
Name:Monoamine transporter
Synonyms:5-HT Transporter | 5HT transporter | 5HTT | SERT | SLC6A4 | Serotonin Transporter (SERT) | Serotonin transporter (5HTT) | Serotonin transporter protein (SERT) | Sodium-dependent serotonin transporter (SERT) | Solute carrier family 6 member 4
Type:Multi-pass membrane protein
Mol. Mass.:70322.51
Organism:Homo sapiens (Human)
Description:P31645
Residue:630
Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140053
n/a
NameBDBM50140053
Synonyms:CHEMBL3754496
TypeSmall organic molecule
Emp. Form.C16H19FN2
Mol. Mass.258.3339
SMILESFc1ccc2[nH]cc(CCN(CC=C)CC=C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: