| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2C |
|---|
| Ligand | BDBM50001915 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1547211 (CHEMBL3756318) |
|---|
| Ki | 28±n/a nM |
|---|
| Citation |  Éliás, O; Nógrádi, K; Domány, G; Szakács, Z; Kóti, J; Szántay, C; Tarcsay, Á; Keseru, GM; Gere, A; Kiss, B; Kurkó, D; Kolok, S; Némethy, Z; Kapui, Z; Hellinger, É; Vastag, M; Sághy, K; Kedves, R; Gyertyán, I The influence of 5-HT(2A) activity on a 5-HT(2C) specific in vivo assay used for early identification of multiple acting SERT and 5-HT(2C) receptor ligands. Bioorg Med Chem Lett26:914-20 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2C |
|---|
| Name: | 5-hydroxytryptamine receptor 2C |
|---|
| Synonyms: | 5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 51836.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28335 |
|---|
| Residue: | 458 |
|---|
| Sequence: | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
|---|
| BDBM50001915 |
|---|
| n/a |
|---|
| Name | BDBM50001915 |
|---|
| Synonyms: | 1-(3-chlorophenyl)piperazine | CHEMBL478 | m-Chlorophenylpiperazine | mCPP |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H13ClN2 |
|---|
| Mol. Mass. | 196.677 |
|---|
| SMILES | Clc1cccc(c1)N1CCNCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
