Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM10620
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1547640
IC50 6350±n/a nM
Citation Luo WChen YWang THong CChang LPChang CCYang YCXie SQWang CJ Design, synthesis and evaluation of novel 7-aminoalkyl-substituted flavonoid derivatives with improved cholinesterase inhibitory activities. Bioorg Med Chem 24:672-80 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase
Name:Acetylcholinesterase
Synonyms:Acetylcholinesterase (AChE) | Acetylcholinesterase (EeAChE)
Type:Enzyme
Mol. Mass.:71812.79
Organism:Electrophorus electricus (Electric eel)
Description:n/a
Residue:633
Sequence:
MKILDALLFPVIFIMFFIHLSIAQTDPELTIMTRLGQVQGTRLPVPDRSHVIAFLGIPFA
EPPLGKMRFKPPEPKKPWNDVFDARDYPSACYQYVDTSYPGFSGTEMWNPNRMMSEDCLY
LNVWVPATPRPHNLTVMVWIYGGGFYSGSSSLDVYDGRYLAHSEKVVVVSMNYRVSAFGF
LALNGSAEAPGNVGLLDQRLALQWVQDNIHFFGGNPKQVTIFGESAGAASVGMHLLSPDS
RPKFTRAILQSGVPNGPWRTVSFDEARRRAIKLGRLVGCPDGNDTDLIDCLRSKQPQDLI
DQEWLVLPFSGLFRFSFVPVIDGVVFPDTPEAMLNSGNFKDTQILLGVNQNEGSYFLIYG
APGFSKDNESLITREDFLQGVKMSVPHANEIGLEAVILQYTDWMDEDNPIKNREAMDDIV
GDHNVVCPLQHFAKMYAQYSILQGQTGTASQGNLGWGNSGSASNSGNSQVSVYLYMFDHR
ASNLVWPEWMGVIHGYEIEFVFGLPLEKRLNYTLEEEKLSRRMMKYWANFARTGNPNINV
DGSIDSRRRWPVFTSTEQKHVGLNTDSLKVHKGLKSQFCALWNRFLPRLLNVTENIDDAE
RQWKAEFHRWSSYMMHWKNQFDHYSKQERCTNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10620
n/a
NameBDBM10620
Synonyms:(S)-3-(1-(dimethylamino)ethyl)phenyl ethyl(methyl)carbamate | 3-((1S)-1-(Dimethylamino)ethyl)phenyl N-ethyl N-methyl carbamate | 3-(1-(dimethylamino)ethyl)phenyl ethyl(methyl)carbamate | 3-[(1S)-1-(dimethylamino)ethyl]phenyl N-ethyl-N-methylcarbamate | CHEMBL636 | ENA-713 | Ethyl-methyl-carbamic acid 3-((R)-1-dimethylamino-ethyl)-phenyl ester | Ethyl-methyl-carbamic acid 3-((S)-1-dimethylamino-ethyl)-phenyl ester | Ethyl-methyl-carbamic acid 3-(1-dimethylamino-ethyl)-phenyl ester | Exelon | RIVASTIGMINE | Rivastigmine | Rivastigmine (1) | SDZ-212-713 | SDZ-ENA-713
TypeSmall organic molecule
Emp. Form.C14H22N2O2
Mol. Mass.250.3367
SMILES[H][C@@](C)(N(C)C)c1cccc(OC(=O)N(C)CC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: