Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E synthase
LigandBDBM50393042
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1552429
IC50 0.555000±n/a nM
Citation Schiffler MAAntonysamy SBhattachar SNCampanale KMChandrasekhar SCondon BDesai PVFisher MJGroshong CHarvey AHickey MJHughes NEJones SAKim EJKuklish SLLuz JGNorman BHRathmell RERizzo JRSeng TWThibodeaux SJWoods TAYork JSYu XP Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors. J Med Chem 59:194-205 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E synthase
Name:Prostaglandin E synthase
Synonyms:MPGES-1 | Microsomal prostaglandin E synthase 1 | PGES | PTGES | Prostaglandin E synthase
Type:PROTEIN
Mol. Mass.:17136.74
Organism:Canis familiaris
Description:ChEMBL_109495
Residue:153
Sequence:
MPPPVLALVSGQALPAFLLCSTLLVIKMYVVAVITGQVRLRKKAFANPEDALRHGGLQYC
RSDQDVDRCLRAHRNDMETIYPFLFLGFVYSFLGPDPFIAQMHFLVFFLGRMVHTVAYLG
KLRAPTRSLAYTVAQLPCASMALQIVWEAACHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50393042
n/a
NameBDBM50393042
Synonyms:CHEMBL2152712
TypeSmall organic molecule
Emp. Form.C16H19ClN4O2
Mol. Mass.334.801
SMILESCC(C)(C)C(=O)NCc1ccc(Cl)c(c1)C(=O)Nc1ncc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: