Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E synthase
LigandBDBM50142264
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1552422
IC50 0.385000±n/a nM
Citation Schiffler MAAntonysamy SBhattachar SNCampanale KMChandrasekhar SCondon BDesai PVFisher MJGroshong CHarvey AHickey MJHughes NEJones SAKim EJKuklish SLLuz JGNorman BHRathmell RERizzo JRSeng TWThibodeaux SJWoods TAYork JSYu XP Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors. J Med Chem 59:194-205 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E synthase
Name:Prostaglandin E synthase
Synonyms:Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E2 synthase-1 ( mPGES-1)
Type:Protein
Mol. Mass.:17112.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:152
Sequence:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142264
n/a
NameBDBM50142264
Synonyms:CHEMBL3758186
TypeSmall organic molecule
Emp. Form.C17H21ClN4O2
Mol. Mass.348.827
SMILESCCC(C)(C)C(=O)NCc1ccc(Cl)c(c1)C(=O)Nc1ncc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: