Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 7
LigandBDBM50147620
Substrate/Competitorn/a
Meas. Tech.ChEBML_1558041
Kd 398±n/a nM
Citation Theodoulou NHBamborough PBannister AJBecher IBit RAChe KHChung CWDittmann ADrewes GDrewry DHGordon LGrandi PLeveridge MLindon MMichon AMMolnar JRobson SCTomkinson NCKouzarides TPrinjha RKHumphreys PG Discovery of I-BRD9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition. J Med Chem 59:1425-39 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 7
Name:Bromodomain-containing protein 7
Synonyms:75 kDa bromodomain protein | BP75 | BRD7 | CELTIX1 | Protein CELTIX-1
Type:PROTEIN
Mol. Mass.:74135.71
Organism:Homo sapiens (Human)
Description:ChEMBL_107970
Residue:651
Sequence:
MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKD
RKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKP
LTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFST
MKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSL
KQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD
MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPI
VGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEME
MSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAE
IFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV
TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147620
n/a
NameBDBM50147620
Synonyms:CHEMBL3769507
TypeSmall organic molecule
Emp. Form.C22H22F3N3O3S2
Mol. Mass.497.554
SMILESCCn1cc(-c2cccc(c2)C(F)(F)F)c2sc(cc2c1=O)C(=N)NC1CCS(=O)(=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: