Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 9
LigandBDBM50148387
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1557801
IC50 10±n/a nM
Citation Theodoulou NHBamborough PBannister AJBecher IBit RAChe KHChung CWDittmann ADrewes GDrewry DHGordon LGrandi PLeveridge MLindon MMichon AMMolnar JRobson SCTomkinson NCKouzarides TPrinjha RKHumphreys PG Discovery of I-BRD9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition. J Med Chem 59:1425-39 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 9
Name:Bromodomain-containing protein 9
Synonyms:BRD9 | Bromodomain-containing protein 9 | Rhabdomyosarcoma antigen MU-RMS-40.8
Type:PROTEIN
Mol. Mass.:66994.30
Organism:Homo sapiens (Human)
Description:ChEMBL_108000
Residue:597
Sequence:
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148387
n/a
NameBDBM50148387
Synonyms:CHEMBL3769944
TypeSmall organic molecule
Emp. Form.C22H26N4O3S2
Mol. Mass.458.597
SMILESCN(C)c1cccc(c1)-c1cn(C)c(=O)c2cc(sc12)C(=N)NC1CCS(=O)(=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: