Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranscription intermediary factor 1-alpha
LigandBDBM50148462
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1558044
IC50 3450±n/a nM
Citation Bennett JFedorov OTallant CMonteiro OMeier JGamble VSavitsky PNunez-Alonso GAHaendler BRogers CBrennan PEMüller SKnapp S Discovery of a Chemical Tool Inhibitor Targeting the Bromodomains of TRIM24 and BRPF. J Med Chem 59:1642-7 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Transcription intermediary factor 1-alpha
Name:Transcription intermediary factor 1-alpha
Synonyms:6.3.2.- | E3 ubiquitin-protein ligase TRIM24 | RING finger protein 82 | RNF82 | TIF1 | TIF1-alpha | TIF1A | TRIM24 | Transcription intermediary factor 1-alpha | Tripartite motif-containing protein 24
Type:PROTEIN
Mol. Mass.:116839.55
Organism:Homo sapiens (Human)
Description:ChEMBL_107998
Residue:1050
Sequence:
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148462
n/a
NameBDBM50148462
Synonyms:CHEMBL3770886
TypeSmall organic molecule
Emp. Form.C18H21N3O3S
Mol. Mass.359.443
SMILESCC(C)c1ccc(cc1)S(=O)(=O)Nc1ccc2n(C)c(=O)n(C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: