Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM50380399
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1556993
IC50 2340±n/a nM
Citation Reddy DNBallante FChuang TPirolli AMarrocco BMarshall GR Design and Synthesis of Simplified Largazole Analogues as Isoform-Selective Human Lysine Deacetylase Inhibitors. J Med Chem 59:1613-33 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380399
n/a
NameBDBM50380399
Synonyms:CHEMBL2018302 | Tubastatin A | US8748451, 6 | US9249087, Tubacin | US9751832, Tubastatin A
TypeSmall organic molecule
Emp. Form.C20H21N3O2
Mol. Mass.335.3996
SMILESCN1CCc2c(C1)c1ccccc1n2Cc1ccc(cc1)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: