Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4C
LigandBDBM50151392
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1561031
IC50 4800±n/a nM
Citation Korczynska MLe DDYounger NGregori-Puigjané ETumber AKrojer TVelupillai SGileadi CNowak RPIwasa EPollock SBOrtiz Torres IOppermann UShoichet BKFujimori DG Docking and Linking of Fragments To Discover Jumonji Histone Demethylase Inhibitors. J Med Chem 59:1580-98 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4C
Name:Lysine-specific demethylase 4C
Synonyms:GASC-1 protein | GASC1 | Gene amplified in squamous cell carcinoma 1 protein | JHDM3C | JMJD2C | JmjC domain-containing histone demethylation protein 3C | Jumonji domain-containing protein 2C | KDM4C | KIAA0780
Type:Protein
Mol. Mass.:119979.01
Organism:Homo sapiens (Human)
Description:Q9H3R0
Residue:1056
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151392
n/a
NameBDBM50151392
Synonyms:CHEMBL3775262
TypeSmall organic molecule
Emp. Form.C19H14N2O5
Mol. Mass.350.3249
SMILESOC(=O)c1ccnc(c1)-c1cc(NC(=O)c2ccc(O)cc2)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: