Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM50151859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1561703
IC50 28000±n/a nM
Citation Wills VSAllen CHolstein SAWiemer DF Potent Triazole Bisphosphonate Inhibitor of Geranylgeranyl Diphosphate Synthase. ACS Med Chem Lett 6:1195-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151859
n/a
NameBDBM50151859
Synonyms:CHEMBL3775876
TypeSmall organic molecule
Emp. Form.C15H23N3Na4O6P2
Mol. Mass.495.2662
SMILES[Na+].[Na+].[Na+].[Na+].[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]-n1cc(-[#6]-[#6](P([#8-])([#8-])=O)P([#8-])([#8-])=O)nn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: