| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM50152140 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1565467 (CHEMBL3782136) |
|---|
| IC50 | 22±n/a nM |
|---|
| Citation |  Petrocchi, A; Leo, E; Reyna, NJ; Hamilton, MM; Shi, X; Parker, CA; Mseeh, F; Bardenhagen, JP; Leonard, P; Cross, JB; Huang, S; Jiang, Y; Cardozo, M; Draetta, G; Marszalek, JR; Toniatti, C; Jones, P; Lewis, RT Identification of potent and selective MTH1 inhibitors. Bioorg Med Chem Lett26:1503-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 7,8-dihydro-8-oxoguanine triphosphatase | 8ODP_HUMAN | MTH1 | MutT homolog 1 protein (MTH1) | NUDT1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 197 |
|---|
| Sequence: | MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVL
LGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPE
LMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKF
QGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM50152140 |
|---|
| n/a |
|---|
| Name | BDBM50152140 |
|---|
| Synonyms: | CHEMBL3781296 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H14ClN3O2 |
|---|
| Mol. Mass. | 231.679 |
|---|
| SMILES | CC(C)(CO)COc1nc(N)ncc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
