Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 2 (SGLT2)
LigandBDBM50315426
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1563453
Ki 1.1±n/a nM
Citation Flick ACDing HXLeverett CAKyne RELiu KKFink SJO'Donnell CJ Synthetic approaches to the 2014 new drugs. Bioorg Med Chem 24:1937-80 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 2 (SGLT2)
Name:Sodium/glucose cotransporter 2 (SGLT2)
Synonyms:Na(+)/glucose cotransporter 2 | Sodium-Dependent Glucose Cotransporter 2 (SGLT2) | Sodium-dependent glucose cotransporter 2 (SGLT2) | Sodium/glucose cotransporter 1 (SGLT1) | Sodium/glucose cotransporter 2 | Solute carrier family 5 member 2
Type:Protein
Mol. Mass.:72902.00
Organism:Homo sapiens (Human)
Description:P31639
Residue:672
Sequence:
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315426
n/a
NameBDBM50315426
Synonyms:(1S)-1,5-Anhydro-1-[5-(4-ethoxybenzyl)-2-methoxy-4-methylphenyl]-1-thio-D-glucitol | CHEMBL1093423
TypeSmall organic molecule
Emp. Form.C23H30O6S
Mol. Mass.434.546
SMILESCCOc1ccc(Cc2cc([C@@H]3S[C@H](CO)[C@@H](O)[C@H](O)[C@H]3O)c(OC)cc2C)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: