Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50152844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1563479
Ki 19±n/a nM
Citation Gadhiya SMadapa SKurtzman TAlberts ILRamsey SPillarsetty NKKalidindi THarding WW Tetrahydroprotoberberine alkaloids with dopamine ands receptor affinity. Bioorg Med Chem 24:2060-71 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152844
n/a
NameBDBM50152844
Synonyms:CHEMBL3780140
TypeSmall organic molecule
Emp. Form.C24H31NO4
Mol. Mass.397.5072
SMILESCCCCCOc1ccc2CC3N(CCc4cc(OC)c(O)cc34)Cc2c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: