Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4C
LigandBDBM50153331
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1562428
IC50 63±n/a nM
Citation Westaway SMPreston AGBarker MDBrown FBrown JACampbell MChung CWDiallo HDouault CDrewes GEagle RGordon LHaslam CHayhow TGHumphreys PGJoberty GKatso RKruidenier LLeveridge MLiddle JMosley JMuelbaier MRandle RRioja IRueger ASeal GASheppard RJSingh OTaylor JThomas PThomson DWilson DMLee KPrinjha RK Cell Penetrant Inhibitors of the KDM4 and KDM5 Families of Histone Lysine Demethylases. 1. 3-Amino-4-pyridine Carboxylate Derivatives. J Med Chem 59:1357-69 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4C
Name:Lysine-specific demethylase 4C
Synonyms:GASC-1 protein | GASC1 | Gene amplified in squamous cell carcinoma 1 protein | JHDM3C | JMJD2C | JmjC domain-containing histone demethylation protein 3C | Jumonji domain-containing protein 2C | KDM4C | KIAA0780
Type:Protein
Mol. Mass.:119979.01
Organism:Homo sapiens (Human)
Description:Q9H3R0
Residue:1056
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153331
n/a
NameBDBM50153331
Synonyms:CHEMBL3774552
TypeSmall organic molecule
Emp. Form.C11H10N2O2S
Mol. Mass.234.274
SMILESOC(=O)c1ccncc1NCc1ccsc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: