Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone Lysine Demethylase
LigandBDBM50153322
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1562434
IC50 40±n/a nM
Citation Westaway SMPreston AGBarker MDBrown FBrown JACampbell MChung CWDiallo HDouault CDrewes GEagle RGordon LHaslam CHayhow TGHumphreys PGJoberty GKatso RKruidenier LLeveridge MLiddle JMosley JMuelbaier MRandle RRioja IRueger ASeal GASheppard RJSingh OTaylor JThomas PThomson DWilson DMLee KPrinjha RK Cell Penetrant Inhibitors of the KDM4 and KDM5 Families of Histone Lysine Demethylases. 1. 3-Amino-4-pyridine Carboxylate Derivatives. J Med Chem 59:1357-69 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone Lysine Demethylase
Name:Histone Lysine Demethylase
Synonyms:2-OG-Dependent Histone Demethylase JMJD2E | Jumonji domain-containing protein 2E (JMJD2E) | KDM4D-like protein | Lysine-specific demethylase 4D-like | Lysine-specific demethylase 4E | Lysine-specific demethylase 4E (KDM4E)
Type:Enzyme
Mol. Mass.:56815.71
Organism:Homo sapiens (Human)
Description:B2RXH2
Residue:506
Sequence:
MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMY
DDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQ
RYWKSHPGNPPIYGADISGSLFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLR
HKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDY
GKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVAESQELSNWRD
DIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLL
MGTRSRAQGHRPQLPLANDLMTNLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153322
n/a
NameBDBM50153322
Synonyms:CHEMBL3775612
TypeSmall organic molecule
Emp. Form.C13H12N2O2
Mol. Mass.228.2466
SMILESOC(=O)c1ccncc1NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: