Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 9
LigandBDBM50347389
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1561754
IC50 2180±n/a nM
Citation Vymetalová LHavlícek L?turc ASkrá?ková ZJorda RPospí?il TStrnad MKry?tof V 5-Substituted 3-isopropyl-7-[4-(2-pyridyl)benzyl]amino-1(2)H-pyrazolo[4,3-d]pyrimidines with anti-proliferative activity as potent and selective inhibitors of cyclin-dependent kinases. Eur J Med Chem 110:291-301 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 9
Name:Cyclin-dependent kinase 9
Synonyms:C-2K | CDC2L4 | CDK9 | Cell division cycle 2-like protein kinase 4 | Cell division protein kinase 9 | Cyclin-Dependent Kinase 9 (CDK9) | Cyclin-dependent kinase 9 (CDK9) | Serine/threonine-protein kinase PITALRE | TAK | Tat-associated kinase complex catalytic subunit
Type:Enzyme Subunit
Mol. Mass.:42789.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50347389
n/a
NameBDBM50347389
Synonyms:CHEMBL1801932
TypeSmall organic molecule
Emp. Form.C22H32N6
Mol. Mass.380.5297
SMILESCC(C)c1cnn2c(NCc3ccccc3)cc(NCCCCCCN)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: