Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone lysine demethylase PHF8
LigandBDBM50155505
Substrate/Competitorn/a
Meas. Tech.ChEBML_1565735
IC50<250±n/a nM
Citation Abdel-Magid AF Inhibition of Histone Demethylases Offers a Novel and Promising Approach for the Treatment of Cancer and Other Diseases. ACS Med Chem Lett 7:128-30 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone lysine demethylase PHF8
Name:Histone lysine demethylase PHF8
Synonyms:Histone lysine demethylase PHF8 (PHF8) | Lysine-specific demethylase 7A/7B | PHD finger protein 8
Type:Protein
Mol. Mass.:117889.91
Organism:Homo sapiens (Human)
Description:Q9UPP1
Residue:1060
Sequence:
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGS
PTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKA
ERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDER
LGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGN
GSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQ
AWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAA
TPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRP
SVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50155505
n/a
NameBDBM50155505
Synonyms:CHEMBL3781414
TypeSmall organic molecule
Emp. Form.C14H19N3O3
Mol. Mass.277.319
SMILESCCN1CCC(CNCc2cc(ccn2)C(O)=O)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: