Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetp38 delta/gamma
LigandBDBM50156129
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1563502
IC50 354±n/a nM
Citation Onions STIto KCharron CEBrown RJColucci MFrickel FHardy GJoly KKing-Underwood JKizawa YKnowles IMurray PJNovak ARani ARapeport GSmith AStrong PTaddei DMWilliams JG Discovery of Narrow Spectrum Kinase Inhibitors: New Therapeutic Agents for the Treatment of COPD and Steroid-Resistant Asthma. J Med Chem 59:1727-46 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
p38 delta/gamma
Name:p38 delta/gamma
Synonyms:MAP kinase p38 gamma | Mitogen-activated protein kinase 12 (MAPK12 p38 gamma) | Mitogen-activated protein kinase 12 (p38 gamma) | Mitogen-activated protein kinase p38 gamma (p38 MAPKγ)
Type:Protein
Mol. Mass.:41938.69
Organism:Homo sapiens (Human)
Description:P53778
Residue:367
Sequence:
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156129
n/a
NameBDBM50156129
Synonyms:CHEMBL3782036
TypeSmall organic molecule
Emp. Form.C35H38N6O4
Mol. Mass.606.714
SMILESCOCC(=O)Nc1cnccc1CCOc1ccc(NC(=O)Nc2cc(nn2-c2ccc(C)cc2)C(C)(C)C)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: