Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 7
LigandBDBM50009463
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1565742
IC50 73000±n/a nM
Citation Milosevich NGignac MCMcFarlane JSimhadri CHorvath SDaze KDCroft CSDheri AQuon TTDouglas SFWulff JEPaci IHof F Selective Inhibition of CBX6: A Methyllysine Reader Protein in the Polycomb Family. ACS Med Chem Lett 7:139-44 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Chromobox protein homolog 7
Name:Chromobox protein homolog 7
Synonyms:CBX7 | Chromobox protein homolog 7
Type:Protein
Mol. Mass.:28351.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:251
Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009463
n/a
NameBDBM50009463
Synonyms:CHEMBL3234145
TypeSmall organic molecule
Emp. Form.C35H52N7O8
Mol. Mass.698.8289
SMILESC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCC[N+](C)(C)C)C(=O)N[C@@H](CO)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: