Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 26B1
LigandBDBM50157604
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1567868
IC50 1700±n/a nM
Citation Diaz PHuang WKeyari CMButtrick BPrice LGuilloteau NTripathy SSperandio VGFronczek FRAstruc-Diaz FIsoherranen N Development and Characterization of Novel and Selective Inhibitors of Cytochrome P450 CYP26A1, the Human Liver Retinoic Acid Hydroxylase. J Med Chem 59:2579-95 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 26B1
Name:Cytochrome P450 26B1
Synonyms:CYP26A2 | CYP26B1 | Cytochrome P450 26A2 | Cytochrome P450 26B1 | Cytochrome P450 retinoic acid-inactivating 2 | Cytochrome P450RAI-2 | P450RAI2 | Retinoic acid-metabolizing cytochrome
Type:PROTEIN
Mol. Mass.:57525.03
Organism:Homo sapiens (Human)
Description:ChEMBL_115648
Residue:512
Sequence:
MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIG
ETGHWLLQGSGFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRS
TRMLLGPNTVSNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAIN
VYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQAR
QILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYAT
TASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKE
VMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVL
HPVDGLSVKFFGLDSNQNEILPETEAMLSATV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157604
n/a
NameBDBM50157604
Synonyms:CHEMBL3786324
TypeSmall organic molecule
Emp. Form.C24H30O2
Mol. Mass.350.4938
SMILESCC1(C)CCC(C)(C)c2cc(Cc3ccc(CCC(O)=O)cc3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: