| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50005209 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1570460 |
|---|
| Ki | <1.000000±n/a nM |
|---|
| Citation |  Nishiguchi, GA; Burger, MT; Han, W; Lan, J; Atallah, G; Tamez, V; Lindvall, M; Bellamacina, C; Garcia, P; Feucht, P; Zavorotinskaya, T; Dai, Y; Wong, K Design, synthesis and structure activity relationship of potent pan-PIM kinase inhibitors derived from the pyridyl carboxamide scaffold. Bioorg Med Chem Lett26:2328-32 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50005209 |
|---|
| n/a |
|---|
| Name | BDBM50005209 |
|---|
| Synonyms: | CHEMBL3103867 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23FN6O |
|---|
| Mol. Mass. | 406.456 |
|---|
| SMILES | N[C@H]1CCCN(C1)c1ccncc1NC(=O)c1nc(ccc1N)-c1ccccc1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
